Product SpecificationSpecies | Human | Synonyms | Butyrophilin subfamily 3 member A1, CD277, BTF5 | Accession | O00481 | Amino Acid Sequence | Protein sequence (O00481, Gln30-Gly254, with C-10*His)
QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIMRGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIAALAGGGGGSHHHHHHHHHH | Expression System | HEK293 | Molecular Weight | Predicted MW: 25.8 kDa
Observed MW: 30 kDa | Purity | >95% by SDS-PAGE | Endotoxin | <1EU/μg | Tag | with C-10*His | Physical Appearance | Lyophilized Powder | Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. | Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. | Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles. |
BackgroundHuman butyrophilin subfamily 3 member A (BTN3A), also known as CD277, includes isoforms BTN3A1, BTN3A2, and BTN3A3 and is structurally associated with B7 costimulatory molecules. Each BTN3A isoform consists of an extracellular N-terminal Ig variable (V) domain and a near-membrane Ig constant (C) region connected to a single transmembrane domain. BTN3A family members have emerged as important molecules modulating the function of Vγ9Vδ2 T cells. The B30.2 intracellular domain plays an important role in this process. Only the intracellular B30.2 domain of BTN3A1 directly binds phosphorylated antigens (pAgs) through a positively charged pocket to activate Vγ9Vδ2 T cells. BTN3A1 is expressed in many tumors, such as ovarian cancer, bladder cancer, breast cancer, renal cell carcinoma and pancreatic ductal adenocarcinoma. The prognostic role of BTN3A1 in different cancers varies substantially. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|