Product Specification| Species | Felis catus | | Synonyms | T-cell surface antigen T4/Leu-3 | | Accession | P79355 | | Amino Acid Sequence | Protein sequence (P79355, Met1-Thr413 (Lys20Glu, Ser84Cys, Val103Ile, Asn115Asp, Ser142Thr, Ser169Gly & insertions of SerThr between Thr148 and Ser149), with C-10*His)
MNQGAVFRHLLLVLQLVMLEAAVPQGKEVVLGKAGGTAELPCQASQKKYMTFTWRLSSQVKILESQHSSLCLTGSSKLKTRFECKKILWDQGSFPLVIKSLQIADSGIYTCEVEDKKREVELLVFGLTAKVDPSGSGGSSSTSTSTSTSTSIYLLQGQSLTLTLESPSGSNPSVQWKGPGNKSKSGVHSLSLSQLELQESGTCTCTVSQSQKTLVFNTNILVLAFRKVSNTVYAKEGEQVEFSFPLNFEDENLMGNLRWKAEGAPSSLLWISFTLKNKQLSVKEVDPYSKLQMMDSLPLRFTLPNVLSRYAGSGNLTLVLDKGQLQQEVKLVVMRVTQSGNNLTCEVLGPTSPELTLSLKLKGQAAKVSKQQKMVRVEDAEAGTWQCLLSHKDKVLLASKAEVLPPVLTRTWTGGGGSHHHHHHHHHH | | Expression System | HEK293 | | Molecular Weight | Predicted MW: 46.8 kDa
Observed MW: 50 kDa | | Purity | >95% by SDS-PAGE | | Endotoxin | <1EU/μg | | Tag | with C-10*His | | Physical Appearance | Lyophilized Powder | | Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. | | Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. | | Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles. |
BackgroundCD4 (cluster of differentiation 4) is a glycoprotein that serves as a co-receptor for the T-cell receptor (TCR). CD4 is found on the surface of immune cells such as T helper cells, monocytes, macrophages, and dendritic cells. CD4+ T helper cells are white blood cells that are an essential part of the immune system. They are called helper cells because one of their main roles is to send signals to other types of immune cells, including CD8 killer cells, which then destroy the infectious particle. If CD4 cells become depleted, the body is left vulnerable to a wide range of infections that it would otherwise have been able to fight. CD4 continues to be expressed in most neoplasms derived from T helper cells. The antigen has also been associated with a number of autoimmune diseases such as type I diabetes mellitus. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|