Product SpecificationSpecies | Anaplasma marginale | Accession | X5DSL3 | Amino Acid Sequence | Protein sequence (X5DSL3, Met1-Lys236, with N-6*His)
MGSSHHHHHHSSGLVPRGSHMVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK | Expression System | E.coli | Molecular Weight | Predicted MW: 28.9 kDaObserved MW: 10, 19, 28.9 kDa | Purity | >95% by SDS-PAGE | Physical Appearance | Lyophilized Powder | Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. | Reconstitution | Reconstitute no more than 1 mg/ml according to the size in deionized water after rapid centrifugation. | Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles. |
BackgroundmCherry is a member of the mFruits family of monomeric red fluorescent proteins (mRFPs). mCherry absorbs light between 540-590 nm and emits light in the range of 550-650 nm. mCherry, out of all of the true monomers developed, has the longest wavelengths, the highest photostability, fastest maturation, excellent pH resistance, and is closest to mRFP1 in its excitation and emission maxima. mCherry belongs to the group of fluorescent protein chromophores used as instruments to visualize genes and analyze their functions in experiments. mCherry is used in fluorescence microscopy as an intracellular probe. It can also be used as a long-wavelength hetero-FRET (fluorescence resonant energy transfer) acceptor and probe for homo-FRET experiments. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|