HBV Surface Antigen-preS2,specification,price,image-Bio-Equip in China

Product Detail
Company Profile

Product Specification

Species	HBV
Synonyms	Middle surface antigen; PreS2
Amino Acid Sequence	MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPN
Expression System	E.coli
Molecular Weight	5.8 kDa(Reducing)
Purity	＞95%, by SDS-PAGE under reducing conditions
Endotoxin	<1EU/μg
Conjugation	Unconjugated
Tag	His Tag
Physical Appearance	Lyophilized Powder
Storage Buffer	20mM PB, 50mM NaCl, pH7.4
Reconstitution	Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .
Stability & Storage	· 12 months from date of receipt, -20 to -70 °C as supplied. · 6 months, -20 to -70 °C under sterile conditions after reconstitution. · 1 week, 2 to 8 °C under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.

Background

Hepatitis B surface antigen S2 (HBV Surface Antigen-preS2) is the smallest unit of transcriptional activator encoded by the surface gene of hepatitis B virus (HBV). It can be used as an auxiliary diagnostic reagent for hepatitis B virus infection. It exists in more than 1/3 of HBV integration units, and HBV integration units are an important factor in inducing liver cancer (HCC). HBV Surface Antigen-preS2 is also an effective regulator of apoptosis induced by tumor necrosis factor-related apoptosis-inducing ligand (TRAIL). It is involved in promoting hepatocyte apoptosis induced by TRAIL, thereby increasing the risk of malignant transformation of human hepatocellular carcinoma cell line (HepG2).