|
Spike RBD His Tag, SARS-CoV-2(BA.2/Omicron)
Origin of place |
Singapore  |
Model |
S0A2043-100μg |
Supplier |
ANT BIO PTE.LTD. |
Price |
500 |
Hits |
2 |
Updated |
8/25/2025 |
|
Product SpecificationSpecies | SARS-CoV-2 | Accession | P0DTC2 | Amino Acid Sequence | Arg319-Phe541, with C-terminal 8*His
RVQPTESIVRFPNITNLCPFDEVFNATRFASVYAWNRKRISNCVADYSVLYNFAPFFAFKCYGVSPTKLNDLCFTNVYADSFVIRGNEVSQIAPGQTGNIADYNYKLPDDFTGCVIAWNSNKLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGNKPCNGVAGVNCYFPLQSYGFRPTYGVGHQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFGGGSHHHHHHHH | Expression System | HEK293 | Molecular Weight | 33-40kDa(Reducing) | Purity | >95% by SDS-PAGE | Endotoxin | <0.1EU/μg | Conjugation | Unconjugated | Tag | His Tag | Physical Appearance | Lyophilized Powder | Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. | Stability & Storage | · 12 months from date of receipt, -20 to -70 °C as supplied. · 6 months, -20 to -70 °C under sterile conditions after reconstitution. · 1 week, 2 to 8 °C under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
BackgroundSevere acute respiratory syndrome coronavirus 2(SARS-CoV-2) has continued to adapt for human infection and transmission, resulting in several variants of concern. While most mutations occur within a single lineage, a small number are shared across multiple variants. The SARS-CoV-2 nucleocapsid (N) gene is one hotspot for coding mutations. Nucleoproteins localize to the cytoplasm and the nucleolus, a subnuclear structure, in both virus-infected primary cells and in cells transfected with plasmids that express N protein. The coronavirus N protein is required for coronavirus RNA synthesis and has RNA chaperone activity that may be involved in template switch. Nucleocapsid protein is a highly immunogenic phosphoprotein also implicated in viral genome replication and in modulating cell signaling pathways. Because of N protein sequence and its strong immunogenicity, the N protein of coronavirus is chosen as a diagnostic tool.
The mutations are identified on the SARS-CoV-2 Omicron variant Pango lineage BA.2. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|
|
|