DENR His Tag, Human,specification,price,image-Bio-Equip in China

Product Detail
Company Profile

Product Specification

Species	Human
Antigen	DENR
Synonyms	Protein DRP1, Smooth muscle cell-associated protein 3 (SMAP-3)
Accession	O43583
Amino Acid Sequence	Met1-Lys198, with N-terminal 8*His HHHHHHHHMAADISESSGADCKGDPRNSAKLDADYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPNEFAKLTVENSPKQEAGISEGQGTAGEEEEKKKQKRGGRGQIKQKKKTVPQKVTIAKIPRAKKKYVTRVCGLATFEIDLKEAQRFFAQKFSCGASVTGEDEIIIQGDFTDDIIDVIQEKWPEVDDDSIEDLGEVKK
Expression System	E.coli
Molecular Weight	27kDa
Purity	＞95% by SDS-PAGE
Endotoxin	<0.1EU/μg
Conjugation	Unconjugated
Tag	His Tag
Physical Appearance	Lyophilized Powder
Storage Buffer	PBS, pH7.4
Reconstitution	Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage	12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.
Reference	1. Deyo J.E., Chiao P.J., Tainsky M.A. drp, a novel protein expressed at high cell density but not during growth arrest. DNA Cell Biol. 1998;17(5):437-447. 2. Oh J.J. Identification of differentially expressed genes associated with HER-2/neu overexpression in human breast cancer cells. Nucleic Acids Res. 1999;27(20):4008-4017. 3. Lomakin I.B. Crystal structure of the human ribosome in complex with DENR-MCT-1. Cell Rep. 2017;20(3):521-528. 4. Skabkin M.A. Activities of Ligatin and MCT-1/DENR in eukaryotic translation initiation and ribosomal recycling. Genes Dev. 2010;24(16):1787-1801. 5. Weisser, M., et al., Structural and functional insights into human re-initiation complexes. Mol Cell, 2017;67(3): p. 447-456.

Background

The density regulated protein (DENR) was discovered as a protein, whose synthesis is increased at high cell density. It is also overexpressed in breast and ovarian cancers. In translation, DENR functions as a stable heterodimer with malignant T-cell-amplified sequence 1, which interacts with the 40S ribosomal subunit during initiation, reinitiation and recycling stages. Diseases associated with DENR include Hypertrichosis Universalis Congenita, Ambras Type and Optic Nerve Disease.