Epididymis protein 4(HE4) His Tag, Human,specification,price,image-Bio-Equip in China

Product Detail
Company Profile

Product Specification

Species	Human
Synonyms	Epididymis 4(HE4);WAP Four-Disulfide Core Domain Protein 2, Epididymal Secretory Protein E4, Major Epididymis-Specific Protein E4, Putative Protease Inhibitor WAP5, WFDC2, HE4, WAP5
Accession	Q14508
Amino Acid Sequence	EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNFHHHHHH
Expression System	HEK293
Molecular Weight	major bands at 19 kDa and 22-26 kDa respectively which are due to post-translational modifications.
Purity	＞95%, by SDS-PAGE under reducing conditions
Endotoxin	<2EU/μg
Conjugation	Unconjugated
Tag	His Tag
Physical Appearance	Lyophilized Powder
Storage Buffer	PBS, pH7.4
Reconstitution	Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .
Stability & Storage	· 12 months from date of receipt, -20 to -70 °C as supplied. · 6 months, -20 to -70 °C under sterile conditions after reconstitution. · 1 week, 2 to 8 °C under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.

Background

Human epididymal protein 4 (HE4) belongs to the whey acidic 4-disulfide center (WFDC) protein family and has the characteristics of suspected trypsin inhibitors. Mature human HE4 contains 94 amino acids (aa) and consists of two core structures: a natural N-terminal glycosylated protein of about 25KDa and two core regions of whey acidic protein (WAP, which consists of four disulfide core regions and eight cysteine residues). WFDC2 / HE4 can undergo a series of complex alternative splicing events and may produce five different protein subtypes containing WAP domains. It is expressed in many normal tissues, including the male reproductive system, respiratory region and nasopharynx. It is highly expressed in ovarian, colon, breast, lung, kidney and other tumor cell lines.