Product Specification| Species | Human | | Synonyms | Fatty acid binding protein 7 | | Accession | O15540 | | Amino Acid Sequence | Val2-Ala132, with N-terminal 8*His
MHHHHHHHHVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA | | Expression System | E.coli | | Molecular Weight | 16kDa (Reducing) | | Purity | >95% by SDS-PAGE & RP-HPLC | | Endotoxin | <1EU/μg | | Conjugation | Unconjugated | | Tag | His Tag | | Physical Appearance | Lyophilized Powder | | Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. | | Stability & Storage | · 12 months from date of receipt, -20 to -70 °C as supplied. · 6 months, -20 to -70 °C under sterile conditions after reconstitution. · 1 week, 2 to 8 °C under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
BackgroundFatty acid binding protein 7 (FABP7, alternative names brain FABP (B-FABP), brain lipid-binding protein (BLBP) and mammary derived growth inhibitor-related gene (MRG)). Compared to normal brain tissue and low-grade astrocytomas, FABP7 is up-regulated in glioblastoma, and increased nuclear localization of FABP7 in glioblastoma is associated with EGFR amplification and poorer outcomes. The expression of FABP7 is also linked to enhanced cell motility and migration, with a decreasing docosahexaenoic acid (DHA, [ω-3])-arachidonic acid (AA, [ω-6]) ratio appearing to govern these effects, perturbing the normal, tightly regulated ratio of fatty acids in brain tissue and providing increased substrate for prostaglandins such as PGE2 to promote progression. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|