FABP8 His Tag, Human,specification,price,image-Bio-Equip in China

Product Detail
Company Profile

Product Specification

Species	Human
Synonyms	Fatty acid binding protein 8, P2, PMP2
Accession	P02689
Amino Acid Sequence	Ser2-Val132, with N-terminal 8*His MHHHHHHHHSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV
Expression System	E.coli
Molecular Weight	18kDa (Reducing)
Purity	＞95% by SDS-PAGE & RP-HPLC
Endotoxin	<1EU/μg
Conjugation	Unconjugated
Tag	His Tag
Physical Appearance	Lyophilized Powder
Storage Buffer	20mM Tris, 100mM NaCl, pH8.0
Reconstitution	Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage	· 12 months from date of receipt, -20 to -70 °C as supplied. · 6 months, -20 to -70 °C under sterile conditions after reconstitution. · 1 week, 2 to 8 °C under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.

Background

FABP8 (fatty acid binding protein-8; also M [myelin]-FABP, P2 and PMP2) is also known as peripheral myelin protein 2, which is a cytosolic protein found primarily in peripheral nerves. PMP2 is a small, basic, and cytoplasmic lipid binding protein of peripheral myelin. Also, PMP2 may play a role in lipid transport protein in Schwann cells. Furthermore, PMP2 may bind cholesterol. PMP2 is a small, basic, and cytoplasmic lipid binding protein of peripheral myelin, which is a cytosolic protein found primarily in peripheral nerves.