Product Specification| Species | Human | | Synonyms | Retinol-Binding Protein 4; Plasma Retinol-Binding Protein; PRBP; RBP; RBP4 | | Accession | P02753 | | Amino Acid Sequence | ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLLHHHHHH | | Expression System | HEK293 | | Molecular Weight | 23 kDa(Reducing) | | Purity | >95%, by SDS-PAGE under reducing conditions | | Endotoxin | <0.1EU/μg | | Conjugation | Unconjugated | | Tag | His Tag | | Physical Appearance | Lyophilized Powder | | Storage Buffer | 50mM Tris-Hac,10mM CaCl,150mM NaCl, pH7.5 | | Reconstitution | Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation . | | Stability & Storage | · 12 months from date of receipt, -20 to -70 °C as supplied. · 6 months, -20 to -70 °C under sterile conditions after reconstitution. · 1 week, 2 to 8 °C under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
BackgroundRetinol binding protein 4, plasma, also known as RBP4, belongs to the lipocalin family and is the specific carrier for retinol(vitamin A alcohol) in the blood. It is protein that in humans is encoded by the RBP4 gene. RBP4 gene resides just centromeric of the cluster of CYP2C genes on 10q24. The mouse Rbp4 locus is closely linked and just proximal to the locus for phenobarbital-inducible cytochrome P450-2c(Cyp-2c) at the distal end of chromosome 19. It delivers retinol from the liver stores to the peripheral tissues. In plasma, the RBP-retinol complex interacts with transthyretin, which prevents its loss by filtration through the kidney glomeruli. A deficiency of vitamin A blocks secretion of the binding protein posttranslationally and results in defective delivery and supply to the epidermal cells. The standard used in this kit is recombinant protein, with E19-L201 aa sequence, the molecular weight is 22kda. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|