|
Nucleocapsid CTD His Tag, SARS-CoV-2
| Origin of place |
Singapore  |
| Model |
S0A2037-100μg |
| Supplier |
ANT BIO PTE.LTD. |
| Price |
600 |
| Hits |
70 |
| Updated |
3/2/2026 |
|
Product Specification| Species | SARS-CoV-2 | | Synonyms | SARS-CoV-2 coronavirus NP Protein; SARS-CoV-2 np Protein; SARS-CoV-2 novel coronavirus Nucleoprotein Protein | | Accession | P0DTC9 | | Amino Acid Sequence | MHHHHHHHHTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFP. | | Expression System | E.coli | | Molecular Weight | 14.5 kDa (还原状态) | | Purity | >95%, by SDS-PAGE under reducing conditions | | Endotoxin | <2EU/μg | | Conjugation | Unconjugated | | Tag | His Tag | | Physical Appearance | Lyophilized Powder | | Storage Buffer | 20mM PB, 100mM NaCl, pH7.4 | | Reconstitution | Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation . | | Stability & Storage | · 12 months from date of receipt, -20 to -70 °C as supplied. · 6 months, -20 to -70 °C under sterile conditions after reconstitution. · 1 week, 2 to 8 °C under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
BackgroundNucleocapsid, nucleocapsid protein, is an important structural protein of novel coronavirus SARS-CoV-2, which is responsible for wrapping the virus RNA genome and then assembling virus particles. Nucleocapsid has two domains: NTD and CTD, in which CTD has two functions: binding to RNA genome and forming homodimer. There are many positively charged amino acid residues on the surface of CTD protein, which can bind to the negatively charged RNA genome by charge interaction. The two molecules of CTD can form a homodimer through the hydrophobic interaction between β-strands, and then form a higher-order polymer complex. Therefore, CTD plays an important role in the process of virus replication and assembly. In the process of novel coronavirus SARS-CoV-2 therapeutic drug development, CTD inhibitors have become a hot target for drug screening. At the same time, the antigen detection kit developed for CTD provides a more efficient and accurate detection method for SARS-CoV-2 detection. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|
|
|