|
Human papillomavirus type 16 E7, his tag
| Origin of place |
Singapore  |
| Model |
S0A2036-25μg |
| Supplier |
ANT BIO PTE.LTD. |
| Price |
100 |
| Hits |
35 |
| Updated |
12/2/2025 |
|
Product Specification| Species | Human papillomavirus type 16 | | Accession | P03129 | | Amino Acid Sequence | Protein sequence (P03129, Met1-Pro98, with C-10*His)
MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKPGGGGSHHHHHHHHHH | | Expression System | E.coli | | Molecular Weight | Predicted MW: 12.7 kDa
Observed MW: 16, 20 kDa | | Purity | >90% by SDS-PAGE | | Endotoxin | <1EU/μg | | Tag | His Tag, with C-10*His | | Physical Appearance | Lyophilized Powder | | Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. | | Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. | | Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles. |
BackgroundHuman papilloma viruses (HPVs) can be classified as either high-risk or low-risk according to their association with cancer. HPV16 and HPV18 are the most common of the high-risk group while HPV6 and HPV11 are among the low-risk types. Approximately 90% of cervical cancers contain HPV DNA of the high-risk types. Mutational analysis have shown that the E6 and E7 genes of the high-risk HPVs are necessary and sufficient for HPV transforming function. The specific interactions of the E6 and E7 proteins with p53 and pRB, respectively, correlate with HPV high and low risk classifications. The high-risk HPV E7 proteins bind to pRB with a higher affinity than do the low-risk HPV proteins, and only the high-risk HPV E6 proteins form detectable complexes with p53 in vitro. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|
|
|