Rabbit IgG lambda, his tag,specification,price,image-Bio-Equip in China

Product Detail
Company Profile

Product Specification

Species	Rabbit
Amino Acid Sequence	Protein sequence (with C-10*His) QPAVTPSVILFPPSSEELKDNKATLVCLINDFYPGTVKVNWKADGTPVTQGVDTTQPSKQSNSKYAASSFLSLSANQWKSYQSVTCQVTHEGHTVEKSLAPAECSGGGGSHHHHHHHHHH
Expression System	HEK293
Molecular Weight	Predicted MW: 13.0 kDa Observed MW: 17.0 kDa
Purity	＞95% by SDS-PAGE
Tag	with C-10*His
Physical Appearance	Lyophilized Powder
Storage Buffer	Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution	Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage	12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Immunoglobulin G (IgG) is a type of antibody. Representing approximately 75% of serum antibodies in humans, IgG is the most common type of antibody found in blood circulation. IgG molecules are created and released by plasma B cells. Lambda light chains are one of the two classes of light chains present on mammalian immunoglobulins. They are found in combination with kappa light chains. These chains are usually present in a 70:30 ratio of kappa to lambda. Anti-lambda light chain antibodies can nonspecifically bind to multiple isotypes of immunoglobulins.