|
Human RBP4 , His tag
| Origin of place |
Singapore  |
| Model |
S0A9007-10μg |
| Supplier |
ANT BIO PTE.LTD. |
| Price |
100 |
| Hits |
81 |
| Updated |
3/2/2026 |
|
Product Specification| Species | Human | | Synonyms | Plasma retinol-binding protein (PRBP; RBP) | | Accession | P02753 | | Amino Acid Sequence | Protein sequence(P02753, Glu19-Leu201, with C-10*His)
ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLLGGGGSHHHHHHHHHH | | Expression System | HEK293 | | Molecular Weight | Theoretical:22.7kDa Actual:24kDa | | Purity | >90% by SDS-PAGE | | Endotoxin | <1EU/μg | | Tag | His Tag | | Physical Appearance | Lyophilized Powder | | Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4. | | Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. | | Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles. |
BackgroundRetinol binding protein 4, also known as RBP4, is a transporter protein[5] for retinol (vitamin A alcohol). It is mainly, though not exclusively, synthesized in the liver and circulates in the bloodstream as a hepatokine bound to retinol in a complex with transthyretin. RBP4 has been a drug target for ophthalmology research due to its role in vision. RBP4 may also be involved in metabolic diseases as suggested by recent studies. Retinol-binding protein 4 in urine (uRBP4) is a functional biomarker of disease of the proximal renal tubule1. When proximal tubular dysfunction interferes with reabsorption of proteins filtered by the renal glomerulus, striking increases of uRBP4 are found. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|
|
|