Product SpecificationSpecies | TOXGO | Synonyms | Surface antigen P22 | Accession | Q9NBH0 | Amino Acid Sequence | Protein sequence(Q9NBH0, Ser27-Val187, with C-10*His)
STTETPAPIECTAGATKTVEAPSSGSVVFQCGDKLTISPSGEGDVFYGKECTDSRKLTTVLPGAVLKAKVEQPPKGPATYTLSYDGTPEKPQVLCYKCVAEAGAPAGRNNDGGSSAPTPKDCKLIVRVPGADGRVTSGFDPVSLTGKVLAPGLAGLLITFVGGGGSHHHHHHHHHH | Expression System | HEK293 | Molecular Weight | Theoretical:18.0kDa Actual:21kDa | Purity | >95% by SDS-PAGE | Endotoxin | <1EU/μg | Tag | His Tag | Physical Appearance | Lyophilized Powder | Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4. | Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. | Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles. |
BackgroundToxoplasmosis is a parasitic disease caused by Toxoplasma gondii, an apicomplexan. Infections with toxoplasmosis are associated with a variety of neuropsychiatric and behavioral conditions. SAG2A is a 22 kDa protein that is mainly found in the surface of tachyzoites. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|