Product Specification| Species | Human | | Synonyms | 200 kDa neurofilament protein; Neurofilament triplet H protein; NEFH; KIAA0845; NFH | | Accession | P12036 | | Amino Acid Sequence | Protein sequence(P12036, Met1-Gln100, with C-10*His) MMSFGGADALLGAPFAPLHGGGSLHYALARKGGAGGTRSAAGSSSGFHSWTRTSVSSVSASPSRFRGAGAASSTDSLDTLSNGPEGCMVAVATSRSEKEQGGGGSHHHHHHHHHH | | Expression System | HEK293 | | Molecular Weight | Theoretical:11.5kDa Actual:11-30kDa | | Purity | >95% by SDS-PAGE | | Endotoxin | <1EU/μg | | Tag | His Tag | | Physical Appearance | Lyophilized Powder | | Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4. | | Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. | | Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
BackgroundNeurofilament, heavy polypeptide (NEFH) is a protein that in humans is encoded by the NEFH gene.It is the gene for a heavy protein subunit that is combined with medium and light subunits to make neurofilaments, which form the framework for nerve cells.Mutations in the NEFH gene are associated with Charcot-Marie-Tooth disease. Neurofilament heavy (NEFH) is one of the critical proteins required for the formation of the neuronal cytoskeleton and polymorphisms in NEFH are reported as a rare cause of sporadic ALS (sALS). bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|