|
Human Calprotectin(S100A8), His tag
| Origin of place |
Singapore  |
| Model |
S0A0045-25μg |
| Supplier |
ANT BIO PTE.LTD. |
| Price |
100 |
| Hits |
47 |
| Updated |
12/2/2025 |
|
Product Specification| Species | Human | | Synonyms | Calgranulin-A; Calprotectin L1L subunit; Cystic fibrosis antigen (CFAG); Leukocyte L1 complex light chain; Migration inhibitory factor-related protein 8 (MRP-8; p8); Urinary stone protein band A; CAGA | | Accession | P05109 | | Amino Acid Sequence | Protein sequence(P05109, Met1-Glu93, with C-10*His) MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKEGGGGSHHHHHHHHHH | | Expression System | E.coli | | Molecular Weight | Predicted MW: 12.5 kDa Observed MW: 13.0 kDa | | Purity | >95% by SDS-PAGE | | Endotoxin | <1EU/μg | | Tag | His Tag | | Physical Appearance | Lyophilized Powder | | Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. | | Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. | | Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
BackgroundS100A8 is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine. Altered expression of this protein is associated with the disease cystic fibrosis and post COVID-19 condition. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|
|
|