Login    Join free Add to favorites    中文
Home >Products> Reagents >Other Reagents> Human BST2 , His tag
Human BST2 , His tag
Human BST2 , His tag
Origin of place Singapore
Model S0A0044-25μg
Supplier ANT BIO PTE.LTD.
Price 100
Hits 26
Updated 9/1/2025
  • Product Detail
  • Company Profile

Product Specification


SpeciesHuman
SynonymsHM1.24 antigen, Tetherin, CD317
AccessionQ10589
Amino Acid Sequence

Protein sequence(Q10589, Asn49-Ser161, with C-10*His)

NSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSSGGGGSHHHHHHHHHH

Expression SystemHEK293
Molecular WeightTheoretical:14.3kDa Actual:18-25kDa
Purity

>95% by SDS-PAGE

Endotoxin<1EU/μg
TagHis Tag
Physical AppearanceLyophilized Powder
Storage BufferLyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4.
ReconstitutionReconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Tetherin, also known as bone marrow stromal antigen 2, is a lipid raft associated protein that in humans is encoded by the BST2 gene. In addition, tetherin has been designated as CD317 (cluster of differentiation 317). This protein is constitutively expressed in mature B cells, plasma cells and plasmacytoid dendritic cells, and in many other cells, it is only expressed as a response to stimuli from IFN pathway.Tetherin has been shown as a Type-I-IFN biomarker using flow cytometry, B cell Tetherin was used as a Cell-Specific Assay for Response to Type I Interferon Predicts Clinical Features and Flares in Systemic Lupus Erythematosus. Tetherin has also been predicted to be involved in cell adhesion and cell migration. Recently it has, also, been identified as the protein that help stabilize lipid rafts by joining nearby lipid rafts to form a cluster. For some viruses, such as Dengue virus, tetherin inhibits the budding of virions as well as cell-to-cell transmission of the virus. For human cytomegalovirus (HCMV), tetherin promotes entry of the virus, especially during cell differentiation. It has also been shown that tetherin is incorporated into newly formed virions.

bio-equip.cn
Request Infomation

* Name:
Title:
* Tel:
Fax:
* E-mail:
Postcode:
Institution/Company:
Address:
* Country:
Request infomation:
yes no
Request Quotation:
yes no
* Message:
Validated Code:
refresh
I agree to share my inquiry to the other matching suppliers.



Recently viewed products
Copyright(C) 2006-2025 Bio-Equip    E-mail:web@bio-equip.cn   沪ICP备06040519号