E. coli MBP Protein, His tag,specification,price,image-Bio-Equip in China

Product Detail
Company Profile

Product Specification

Species	E. coli
Synonyms	Maltose/maltodextrin-binding periplasmic protein, MMBP, Maltodextrin-binding protein, Maltose-binding protein (MBP), malE
Accession	P0AEX9
Amino Acid Sequence	Protein sequence (P0AEX9, Lys27-Thr392, with C-His tag) KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQT
Expression System	E.coli
Molecular Weight	Predicted MW: 41.8 kDa Observed MW: 42 kDa
Purity	＞95% by SDS-PAGE
Endotoxin	<0.1EU/μg
Conjugation	Unconjugated
Tag	with C-His tag
Physical Appearance	Lyophilized Powder
Storage Buffer	Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution	Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage	12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Maltose-binding protein (MBP) is a part of the maltose/maltodextrin system of Escherichia coli, which is responsible for the uptake and efficient catabolism of maltodextrins. It is a complex regulatory and transport system involving many proteins and protein complexes. MBP has an approximate molecular mass of 42.5 kilodaltons. MBP is used to increase the solubility of recombinant proteins expressed in E. coli. The fusion of proteins with MBP usually enhances their solubility and facilitates their proper folding. In addition, such fusions can facilitate the crystallization of difficult proteins, e.g. membrane proteins. MBP can itself be used as an affinity tag for purification of recombinant proteins.