Human CD81 , His tag,specification,price,image-Bio-Equip in China

Product Detail
Company Profile

Product Specification

Species	Human
Synonyms	26 kDa cell surface protein TAPA-1, Target of the antiproliferative antibody 1, Tetraspanin-28 (Tspan-28), TAPA1, TSPAN28
Accession	P60033
Amino Acid Sequence	Protein sequence(P60033, Phe113-Lys201, with C-10*His) FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKGGGGSHHHHHHHHHH
Expression System	CHO
Molecular Weight	Theoretical:11.4kDa Actual:10kDa
Purity	＞95% by SDS-PAGE
Tag	His Tag
Physical Appearance	Lyophilized Powder
Storage Buffer	Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution	Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage	12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CD81 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. It is a cell surface glycoprotein that is known to complex with integrins. This protein appears to promote muscle cell fusion and support myotube maintenance. Also it may be involved in signal transduction. Studies showed that this protein plays a critical role in Hepatitis C attachment and/or cell entry by interacting with virus' E1/E2 glycoproteins heterodimer. It also appears to play a role in liver invasion by Plasmodium species. Meanwhile, CD81 is required for Plasmodium vivax sporozoite entry into human hepatocytes and for Plasmodium yoelii sporozoite entry into murine hepatocytes.