|
Human CGA, His tag
Origin of place |
Singapore  |
Model |
S0A8003-25μg |
Supplier |
ANT BIO PTE.LTD. |
Price |
85 |
Hits |
30 |
Updated |
9/1/2025 |
|
Product SpecificationSpecies | Human | Synonyms | Anterior putuitary glycoprotein hormones common subunit alpha; Choriogonadotropin alpha chain; Chorionic gonadotrophin subunit alpha (CG-alpha); Follicle-stimulating hormone alpha chain (FSH-alpha); Follitropin alpha chain | Accession | P08515 | Amino Acid Sequence | Protein sequence(P01215, Ala25-Ser116, with C-10*His) APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKSGGGGSHHHHHHHHHH | Expression System | HEK293 | Molecular Weight | Theoretical: 11.8kDa Actual: 25kDa | Purity | >95% by SDS-PAGE | Endotoxin | <1EU/μg | Conjugation | Unconjugated | Tag | His Tag | Physical Appearance | Lyophilized Powder | Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. | Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. | Stability & Storage | 12 months from date of receipt, -20 ℃ to -70 °C as supplied.
1 month, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles. |
BackgroundGlycoprotein hormones, alpha polypeptide is a protein that in humans is encoded by the CGA gene. The gonadotropin hormones, human chorionic gonadotropin, luteinizing hormone, follicle-stimulating hormone, and thyroid-stimulating hormone are heterodimers consisting of alpha and beta subunits that are associated non-covalently. The alpha subunits of these four human glycoprotein hormones are identical; however, their beta chains are unique and confer biological specificity. The protein encoded by this gene is the alpha subunit and belongs to the glycoprotein hormones alpha chain family. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|
|
|