|
Human NKX6.1, His tag
| Origin of place |
Singapore  |
| Model |
S0A6012-25μg |
| Supplier |
ANT BIO PTE.LTD. |
| Price |
85 |
| Hits |
54 |
| Updated |
12/2/2025 |
|
Product Specification| Species | Human | | Synonyms | Homeobox protein NK-6 homolog A | | Accession | P78426 | | Amino Acid Sequence | Protein sequence(P78426, Met1-Pro48&Thr66-Pro120&Pro179-Arg240, with C-10*His) MLAVGAMEGTRQSAFLLSSPPLAALHSMAEMKTPLYPAAYPPLPAGPPGGSGGSTHNPGGLKPPATGGLSSLGSPPQQLSAATPHGINDILSRPSMPVASGAALPSASPGGSGGSPSAAAVAAVGRYPKPLAELPGRTPIFWPGVMQSPPWRDARLACTPHQGSILLDKDGKRKHTRGGGGSHHHHHHHHHH | | Expression System | HEK293 | | Molecular Weight | Theoretical: 19.4kDa Actual: 20-35kDa | | Purity | >95% by SDS-PAGE | | Endotoxin | <1EU/μg | | Conjugation | Unconjugated | | Physical Appearance | Lyophilized Powder | | Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. | | Reconstitution | Reconstitute no more than 0.1 mg/mL according to the size in deionized water after rapid centrifugation. | | Stability & Storage |
- 12 months from date of receipt, -20 ℃ to -70 °C as supplied.
- 1 month, 2 to 8 °C under sterile conditions after reconstitution.
- Please avoid repeated freeze-thaw cycles.
|
BackgroundHomeobox protein NKX6.1 is a transcription factor (TF) that plays a critical role in pancreatic β cell function and proliferation. In human pancreatic islet, NKX6.1 expression is exclusive to β cells and is undetectable in other islet cells. As a Transcription factor, NKX6.1 binds to specific A/T-rich DNA sequences in the promoter regions of a number of genes. Involved in the development of insulin-producing beta cells in the islets of Langerhans at the secondary transition. Together with NKX2-2 and IRX3 acts to restrict the generation of motor neurons to the appropriate region of the neural tube. Belongs to the class II proteins of neuronal progenitor factors, which are induced by SHH signals. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|
|
|