Product Specification| Species | Human | | Synonyms | Catabolin | | Accession | P01584 | | Amino Acid Sequence | Protein sequence (P01584, Ala117-Ser269, with C-10*His)
APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSSGGGGSHHHHHHHHHH | | Expression System | HEK293 | | Molecular Weight | Predicted MW: 19 kDa
Observed MW: 20 kDa | | Purity | >90% by SDS-PAGE | | Endotoxin | <1EU/μg | | Conjugation | Unconjugated | | Tag | with C-10*His | | Physical Appearance | Lyophilized Powder | | Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. | | Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. | | Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
BackgroundInterleukin-1 beta (IL-1β) is a proinflammatory cytokine that is mainly produced by monocytes and activated macrophages as a proprotein. Inflammatory responses are mediated by IL-1β in T cells, natural killer cells (NK cells) and B cells. It induces the production of pro-inflammatory cytokines (IL-2, IL-3, IL-6) as well as interferons. Furthermore, IL-1β modulates the secretion of cytokines by various subsets of human DCs. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|