|
Human CGB3, His tag
| Origin of place |
Singapore  |
| Model |
S0A8001-25μg |
| Supplier |
ANT BIO PTE.LTD. |
| Price |
85 |
| Hits |
75 |
| Updated |
12/2/2025 |
|
Product Specification| Species | Human | | Synonyms | Choriogonadotropin subunit beta (CG-beta); Chorionic gonadotropin chain beta | | Accession | P0DN86 | | Amino Acid Sequence | Protein sequence(P0DN86, Ser21-Gln165, with C-10*His) SKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQGGGGSHHHHHHHHHH | | Expression System | HEK293 | | Molecular Weight | Theoretical: 17.2kDa Actual: 33kDa | | Purity | >95% by SDS-PAGE | | Endotoxin | <1EU/μg | | Conjugation | Unconjugated | | Tag | His Tag | | Physical Appearance | Lyophilized Powder | | Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. | | Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. | | Stability & Storage | 12 months from date of receipt, -20 ℃ to -70 °C as supplied.
1 month, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles. |
BackgroundCGB3 is a protein that in humans is encoded by the CGB gene. This gene is a member of the glycoprotein hormone beta chain family and encodes the beta 3 subunit of chorionic gonadotropin. Glycoprotein hormones are heterodimers consisting of a common alpha subunit and a unique beta subunit which confers biological specificity. CG is produced by the trophoblastic cells of the placenta and stimulates the ovaries to synthesize the steroids that are essential for the maintenance of pregnancy. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|
|
|