|
Human CD66b, His tag
| Origin of place |
Singapore  |
| Model |
S0A1010-25μg |
| Supplier |
ANT BIO PTE.LTD. |
| Price |
85 |
| Hits |
105 |
| Updated |
3/2/2026 |
|
Product Specification| Species | Human | | Synonyms | CEAM8, CD67 antigen, Carcinoembryonic antigen CGM6, Non-specific cross-reacting antigen NCA-95 | | Accession | P31997 | | Amino Acid Sequence | Protein sequence(P31997, Met1-Ile349, with C-10*His) MGPISAPSCRWRIPWQGLLLTASLFTFWNPPTTAQLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSDALVQGSSPGLSARATVSIMIGVLARVALIGGGGSHHHHHHHHHH | | Expression System | HEK293 | | Molecular Weight | Theoretical: 39.8kDa Actual: 60-80kDa | | Purity | >95% by SDS-PAGE | | Endotoxin | <1EU/μg | | Conjugation | Unconjugated | | Tag | His Tag | | Physical Appearance | Lyophilized Powder | | Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. | | Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. | | Stability & Storage | 12 months from date of receipt, -20 ℃ to -70 °C as supplied.
1 month, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles. |
BackgroundCD66b is a GPI-anchored glycoprotein of the carcinoembryonic antigen (CEA) family and is located in the specific granules . It is only known to be expressed on human granulocytes and on the granulocytes of two primate species and is associated with the aggregate formation of human neutrophils , Findings suggest that these molecules may play a role in phagocytosis, chemotaxis and adherence. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|
|
|