|
Human GP73, His tag
| Origin of place |
Singapore  |
| Model |
S0A6010-50μg |
| Supplier |
ANT BIO PTE.LTD. |
| Price |
485 |
| Hits |
107 |
| Updated |
12/2/2025 |
|
Product Specification| Species | Human | | Synonyms | Golgi membrane protein GP73, Golgi phosphoprotein 2, GOLM2 | | Accession | Q8NBJ4 | | Amino Acid Sequence | Protein sequence(Q8NBJ4, Arg55-Leu401, with C-10*His) RAAAERGAVELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQFQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRLQAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTLGGGGSHHHHHHHHHH | | Expression System | HEK293 | | Molecular Weight | Theoretical: 41kDa Actual: 65kDa | | Purity | >95% by SDS-PAGE | | Endotoxin | <1EU/μg | | Conjugation | Unconjugated | | Tag | His Tag | | Physical Appearance | Lyophilized Powder | | Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. | | Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. | | Stability & Storage |
- 12 months from date of receipt, -20 ℃ to -70 °C as supplied.
- 1 month, 2 to 8 °C under sterile conditions after reconstitution.
- Please avoid repeated freeze-thaw cycles.
|
BackgroundGolgi protein-73 (GP73) is a type II Golgi-localized integral membrane protein that is normally expressed in epithelial cells of many human tissues. It is essential for human survival, and might have multiple roles for GP73 in epithelial cell function such as in the kidney and liver. GP73 has been suggested as a potential serum marker for the diagnosis of hepatocellular carcinoma (HCC),Several reports have stated that GP73 is a better marker than AFP for diagnos ing HCC. Many studies have demonstrated that significant increases of non-viral causes (alcohol-induced liver dis ease, autoimmune hepatitis). Therefore, some researchers consider that an increase in GP73 expression is a common feature of hepatocyte response to a variety of disease etiologies. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|
|
|