Product Specification| Species | MPXV | | Accession | Q8V4Y0 | | Amino Acid Sequence | Protein sequence(Q8V4Y0, Met1-Thr275, with C-10*His) MPQQLSPINIETKKAISDTRLKTLDIHYNESKPTTIQNTGKLVRINFKGGYISGGFLPNEYVLSTIHIYWGKEDDYGSNHLIDVYKYSGEINLVHWNKKKYSSYEEAKKHDDGIIIIAIFLQVSDHKNVYFQKIVNQLDSIRSANMSAPFDSVFYLDNLLPSTLDYFTYLGTTINHSADAAWIIFPTPINIHSDQLSKFRTLLSSSNHEGKPHYITENYRNPYKLNDDTQVYYSGEIIRAATTSPVRENYFMKWLSDLREACFSYYQKYIEGNKTGGGGSHHHHHHHHHH | | Expression System | HEK293 | | Molecular Weight | Theoretical: 33.5kDa Actual: 37kDa | | Purity | >95% by SDS-PAGE | | Endotoxin | <1EU/μg | | Conjugation | Unconjugated | | Tag | His Tag | | Physical Appearance | Lyophilized Powder | | Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. | | Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. | | Stability & Storage |
- 12 months from date of receipt, -20 ℃ to -70 °C as supplied.
- 1 month, 2 to 8 °C under sterile conditions after reconstitution.
- Please avoid repeated freeze-thaw cycles.
|
BackgroundMonkeypox is a rare disease similar to smallpox caused by the monkeypox virus. It’s found mostly in areas of Africa, but has been seen in other regions of the world. It causes flu-like symptoms such as fever and chills, and a rash that can take weeks to clear. There’s no proven treatment for monkeypox, but it usually goes away on its own.Monkeypox Virus E8L binds to chondroitin sulfate on the cell surface to provide virion attachment to target cell. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|