|
Human PINP, His tag
| Origin of place |
Singapore  |
| Model |
S0A7001-50μg |
| Supplier |
ANT BIO PTE.LTD. |
| Price |
550 |
| Hits |
86 |
| Updated |
12/2/2025 |
|
Product Specification| Species | Human | | Synonyms | Procollagen I N-Terminal Propeptide | | Accession | P02452 | | Amino Acid Sequence | Protein sequence(P02452, Gln23-Pro161, with C-10*His) QEEGQVEGQDEDIPPITCVQNGLRYHDRDVWKPEPCRICVCDNGKVLCDDVICDETKNCPGAEVPEGECCPVCPDGSESPTDQETTGVEGPKGDTGPRGPRGPAGPPGRDGIPGQPGLPGPPGPPGPPGPPGLGGNFAPGGGGSHHHHHHHHHH | | Expression System | HEK293 | | Molecular Weight | Theoretical: 15.9kDa Actual:23kDa | | Purity | >95% by SDS-PAGE | | Endotoxin | <1EU/μg | | Conjugation | Unconjugated | | Tag | His Tag | | Physical Appearance | Lyophilized Powder | | Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. | | Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. | | Stability & Storage | 12 months from date of receipt, -20 ℃ to -70 °C as supplied.
1 month, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles. |
BackgroundType 1 collagen is the major collagen in the body and is mainly found in mineralised bone. It has a triple helical structure consisting of one α1 and two α2 chains which are linked by disulphide bonds. The molecule is synthesised as procollagen which is proteolytically cleaved to remove both the N‐ and C- terminal parts of the molecule prior to the assembly of the remainder into the collagen matrix. The N‐ and C‐terminals are released into the circulation stoichiometrically and thus reflect the synthesis of new type 1 collagen.The amino-terminal propeptide of type I procollagen (PINP) is probably the most specific and sensitive marker of bone formation. PINP is a useful marker for monitoring the efficacy of osteoporosis therapy with anabolic agents, but it is also one of the best bone turnover markers for monitoring the efficacy of anti-resorptive therapy. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|
|
|