|
Human Dystrophin, His Tag
Origin of place |
Singapore  |
Model |
S0A1004-50μg |
Supplier |
ANT BIO PTE.LTD. |
Price |
270 |
Hits |
2 |
Updated |
8/25/2025 |
|
Product SpecificationSpecies | Human | Accession | P11532 | Amino Acid Sequence | Protein sequence(P11532, Gly3046-Thr3306 with C-10*His)
MGPASQHFLSTSVQGPWERAISPNKVPYYINHETQTTCWDHPKMTELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLSLSAACDALDQHNLKQNDQPMDILQIINCLTTIYDRLEQEHNNLVNVPLCVDMCLNWLLNVYDTGRTGRIRVLSFKTGIISLCKAHLEDKYRYLFKQVASSTGFCDQRRLGLLLHDSIQIPRQLGEVASFGGSNIEPSVRSCFQFANNKPEIEAALFLDWMRLEPQSMVWLPVLHRVAAAETGGGGSHHHHHHHHHH
| Expression System | E.coli | Molecular Weight | Theoretical: 31.6kDa Actual: 27kDa | Purity | >95% by SDS-PAGE | Endotoxin | <1EU/μg | Conjugation | Unconjugated | Tag | His Tag | Physical Appearance | Lyophilized Powder | Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. | Stability & Storage | 12 months from date of receipt, -20 ℃ to -70 °C as supplied.
1 month, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles. |
BackgroundDystrophin is a protein located between the sarcolemma and the outermost layer of myofilaments in the muscle fiber (myofiber). It is a cohesive protein, linking actin filaments to other support proteins that reside on the inside surface of each muscle fiber's plasma membrane (sarcolemma).Dystrophin supports muscle fiber strength, and the absence of dystrophin reduces muscle stiffness, increases sarcolemmal deformability, and compromises the mechanical stability of costameres and their connections to nearby myofibrils. Dystrophin deficiency has been definitively established as one of the root causes of the general class of myopathies collectively referred to as muscular dystrophy. The deletions of one or several exons of the dystrophin DMD gene cause Duchenne and Becker muscular dystrophies. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|
|
|