|
Human CD81, His Tag
Origin of place |
Singapore  |
Model |
S0A1007-50μg |
Supplier |
ANT BIO PTE.LTD. |
Price |
265 |
Hits |
41 |
Updated |
9/1/2025 |
|
Product SpecificationSpecies | Human | Synonyms | 26 kDa cell surface protein TAPA-1, Target of the antiproliferative antibody 1, Tetraspanin-28 (Tspan-28) | Accession | P60033 | Amino Acid Sequence | Protein sequence(P60033, Phe113-Lys201, with C-10*His)
FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKGGGGSHHHHHHHHHH
| Expression System | HEK293 | Molecular Weight | Theoretical: 11.4kDa Actual:11kDa | Purity | >95% by SDS-PAGE | Conjugation | Unconjugated | Tag | His Tag | Physical Appearance | Lyophilized Powder | Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. | Stability & Storage | 12 months from date of receipt, -20 ℃ to -70℃ as supplied.
1 month, 2 to 8℃ under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles. |
BackgroundCD81 is a member of the transmembrane 4 superfamily and it is a cell surface glycoprotein that is known to complex with integrins. CD81 appears to promote muscle cell fusion and support myotube maintenance. Also it may be involved in signal transduction. Moreover, CD81 plays a critical role in Hepatitis C attachment and cell entry by interacting with virus' E1/E2 glycoproteins heterodimer. The large extracellular loop of CD81 binds the hepatitis E2 glycoprotein dimer. It also appears to play a role in liver invasion by Plasmodium species. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|
|
|