|
SARS-CoV-2 (BA.2.12.1/Omicron) RBD, His Tag
Origin of place |
Singapore  |
Model |
S0A2015-50μg |
Supplier |
ANT BIO PTE.LTD. |
Price |
250 |
Hits |
2 |
Updated |
8/25/2025 |
|
Product SpecificationSpecies | SARS-CoV-2 | Accession | P0DTC2 | Amino Acid Sequence | Protein sequence(P0DTC2, Arg319-Lys537, with C-10*His)
RVQPTESIVRFPNITNLCPFDEVFNATRFASVYAWNRKRISNCVADYSVLYNFAPFFAFKCYGVSPTKLNDLCFTNVYADSFVIRGNEVSQIAPGQTGNIADYNYKLPDDFTGCVIAWNSNKLDSKVGGNYNYQYRLFRKSNLKPFERDISTEIYQAGNKPCNGVAGFNCYFPLRSYGFRPTYGVGHQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKGGGGSHHHHHHHHHH
| Expression System | HEK293 | Molecular Weight | Theoretical: 26.5kDa Actual: 35kDa | Purity | >95% by SDS-PAGE | Conjugation | Unconjugated | Tag | His Tag | Physical Appearance | Lyophilized Powder | Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. | Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied.
1 month, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles. |
BackgroundSars-cov-2 (2019-NCOV) infects human respiratory epithelial cells through binding to human ACE2 receptors. Spike protein is a large type I transmembrane protein containing two subunits S1 and S2.S1 mainly contains a receptor binding domain (RBD), which is responsible for recognizing cell surface receptors. S2 contains the basic elements required for membrane fusion. S protein plays a key role in inducing neutralizing antibody and T cell responses as well as protective immunity. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|
|
|