Product SpecificationSpecies | MPXV | Synonyms | Mpox, Monkeypox | Accession | Q80KX2 | Amino Acid Sequence | Protein sequence(Q80KX2, Val57-Thr181, with C-10*His)
VRLNQCMSANEAAITDSAVAVAAASSTHRKVASSTTQYDHKESCNGLYYQGSCYILHSDYKSFEDAKANCAAESSTLPNKSDVLTTWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFCTGGGGSHHHHHHHHHH
| Expression System | HEK293 | Molecular Weight | Theoretical: 15.4kDa Actual: 15kDa | Purity | >95% by SDS-PAGE | Conjugation | Unconjugated | Tag | His Tag | Physical Appearance | Lyophilized Powder | Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. | Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied.
1 month, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles. |
BackgroundMonkeypox A35R is a homolog of Vaccinia virus A33R protein. A33R is specifically incorporated into the viral outer envelope. The protein is expressed early and late after infection, cosistent with putative early and late promoter sequences. And it is necessay for efficient cell-to-cell spread. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|