|
Human PIIINP, His Tag
| Origin of place |
Singapore  |
| Model |
S0A3001-50μg |
| Supplier |
ANT BIO PTE.LTD. |
| Price |
265 |
| Hits |
107 |
| Updated |
12/2/2025 |
|
Product Specification| Species | Human | | Synonyms | Collagen alpha-1(III) chain、COL3A1 | | Accession | P02461 | | Amino Acid Sequence | Protein sequence (P02461, Gln24-Pro153, with C-10*His) QQEAVEGGCSHLGQSYADRDVWKPEPCQICVCDSGSVLCDDIICDDQELDCPNPEIPFGECCAVCPQPPTAPTRPPNGQGPQGPKGDPGPPGIPGRNGDPGIPGQPGSPGSPGPPGICESCPTGPQNYSPGGGGSHHHHHHHHHH | | Expression System | HEK293 | | Molecular Weight | 23-30kDa | | Purity | >95% by SDS-PAGE | | Conjugation | Unconjugated | | Tag | His Tag | | Physical Appearance | Lyophilized Powder | | Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. | | Stability & Storage | 12 months from date of receipt, -20 ℃to -70 °C as supplied.
1 month, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles. |
BackgroundPIIINP is the amino terminal peptide of type III procollagen, released from the precursor peptide during the synthesis and deposition of type III collagen. PIIINP in the serum can be derived from the synthesis of new type III collagen or from the degradation of existing type III collagen fibrils. There is evidence that serum PIIINP measurement is an effective non-invasive test for the detection and monitoring of Methotrexate-induced liver fibrosis and cirrhosis, and serial measurements may reduce the need for liver biopsy. Dermatology patients with repeated normal levels of PIIINP are very unlikely to have significant liver damage from fibrosis or cirrhosis. Conversely a high serum PIIINP or series of high values may indicate that a liver biopsy is required and in some cases, that Methotresate should be withdrawn. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|
|
|