Human TNF-alpha, His Tag,specification,price,image-Bio-Equip in China

Species	Human
Accession	P01375
Amino Acid Sequence	VRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIALGGGGSHHHHHHHHHH.
Expression System	HEK293
Molecular Weight	19.0 kDa (reducing)
Purity	＞95% by SDS-PAGE
Endotoxin	<1EU/μg
Conjugation	Unconjugated
Physical Appearance	Lyophilized Powder
Storage Buffer	0.2M PBS, pH7.4
Reconstitution	Reconstitute at less than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage	Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃ Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.