Product SpecificationSpecies | Human | Accession | P01579 | Amino Acid Sequence | QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQGGGGSHHHHHHHHHH. | Expression System | HEK293 | Molecular Weight | 18.5 kDa (Reducing) | Purity | >95% by SDS-PAGE | Endotoxin | <1EU/μg | Conjugation | Unconjugated | Physical Appearance | Lyophilized Powder | Storage Buffer | 0.2M PBS, pH7.4 | Reconstitution | Reconstitute at less than 1 mg/mL according to the size in deionized water after rapid centrifugation. | Stability & Storage | Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃ Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
BackgroundIFN-gamma, the only member of type II interferon, is a soluble dimer cytokine secreted mainly by natural killer cells (NK) and natural killer T cells (NKT) when it functions in innate immunity. During antigen-specific immunity it is secreted by CD4 Th1 and CD8 cytotoxic T cells.IFN-gamma acts on the whole process of tumorigenesis and development, and its anti-tumor mechanism is mainly divided into immune mechanism and non-immune mechanism.IFN-gamma can directly inhibit tumor cell proliferation, promote tumor cell apoptosis, inhibit tumor angiogenesis, and cooperate with NK, NKT, γδT cells and CD4+/CD8+T cells of innate and adaptive immunity to complete tumor killing. In addition, IFN-gamma also has an important immunomodulatory function, which can improve the lysosomal activity of macrophages, and has an anti-proliferation effect on transformed cells.This product is the recombinant human Renin protein expressed from human 293 cells (HEK293). bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|