Product Specification
Species | Human |
Accession | P61769 |
Amino Acid Sequence | IQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDMGGGGSHHHHHHHHHH. |
Expression System | HEK293 |
Molecular Weight | 13.4 kDa (Reducing) |
Purity | >95% by SDS-PAGE |
Endotoxin | <1EU/μg |
Conjugation | Unconjugated |
Physical Appearance | Lyophilized Powder |
Storage Buffer | 0.2M PBS, pH7.4 |
Reconstitution | Reconstitute at less than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
Stability & Storage | Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃ Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Background
β2-MG (β2-microglobulin) is a β-light chain of human leukocyte antigen molecules. Its main function is to participate in lymphocyte surface recognition and is related to killer cell receptor. Almost all nucleated cells in the body can synthesize β2-MG and attach to cell surface. The daily production of β2-MG remains constant and is secreted into various body fluids. β2-MG is produced in lymphocytes and is rarely present in urine because it can pass freely through the glomerular filtration membrane due to low molecular weight. β2-MG filtered from the glomeruli is almost entirely reabsorbed through the tubules. Increased urinary β2-MG excretion indicates tubular reabsorption disorder, called tubular proteinuria. In clinical urine examination, urinary β2-MG is of great significance for the detection of nephropathy.This product is the recombinant human β2-MG protein expressed from human 293 cells (HEK293).
bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.