|
Human HE4, His Tag
| Origin of place |
Singapore  |
| Model |
S0A6003-50μg |
| Supplier |
ANT BIO PTE.LTD. |
| Price |
300 |
| Hits |
226 |
| Updated |
4/23/2026 |
|
Product Specification| Species | Human | | Accession | Q14508 | | Amino Acid Sequence | EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNFGGGGSHHHHHHHHHH. | | Expression System | HEK293 | | Molecular Weight | 11.7 kDa (Reducing) | | Purity | >95% by SDS-PAGE | | Endotoxin | <1EU/μg | | Conjugation | Unconjugated | | Tag | His Tag | | Physical Appearance | Lyophilized Powder | | Storage Buffer | 0.2M PBS, pH7.4 | | Reconstitution | Reconstitute at less than 1 mg/mL according to the size in deionized water after rapid centrifugation. | | Stability & Storage | Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃ Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
BackgroundHE4 (human epididymis protein 4) is a new tumor marker for ovarian cancer, and the incidence of ovarian cancer ranks third among the three gynecological malignancies. Early diagnosis is crucial to the cure rate of ovarian cancer. Normally, HE4 is expressed at very low levels in humans, but it can be very high in the tissues and serum of ovarian cancer patients and has a high sensitivity for ovarian cancer detection, especially in the early asymptomatic stage.This product is the recombinant human HE4 protein expressed from human 293 cells (HEK293). bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|
|
|