Human IL-25, His tag,specification,price,image-Bio-Equip in China

Product Detail
Company Profile

Product Specification

Species	Human
Synonyms	Interleukin-17E (IL-17E), IL17E
Accession	Q9H293
Amino Acid Sequence	Protein sequence(Q9H293, Tyr33-Gly177, with C-10*His) YSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMGGGGGSHHHHHHHHHH
Expression System	HEK293
Molecular Weight	Theoretical:18.4 kDa Actual:20, 23, 27 kDa
Purity	＞95% by SDS-PAGE
Endotoxin	<1EU/mg
Tag	with C-10*His
Physical Appearance	Lyophilized Powder
Storage Buffer	Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution	Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage	12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Interleukin-25 (IL-25) – also known as interleukin-17E (IL-17E) – is a protein that in humans is encoded by the IL25 gene on chromosome 14. IL-25 is produced by many cell types. This cytokine can induce NF-κB activation, and stimulate the production of IL-8 (named also CXCL8), which is the major chemotactic substance of neutrophils. Another important function of interleukin 25 is to support the Th2 immune response. IL-25 has been shown to induce the production of IL-4, IL-5 and IL-13. Because IL-25 promotes the development of a Th2 immune response, it acts to protect against several bowel infections caused by helminths. IL-25 is also referred to as the regulator of IL-9 production. Another function of IL-25 is the activation of natural lymphoid cells 2 (ILC2).