Product Specification| Species | Human | | Synonyms | Bromodomain-containing protein 4, Protein HUNK1, HUNK1 | | Accession | O60885 | | Amino Acid Sequence | Protein sequence (O60885, Ser42-Glu168, with N-His tag)
STNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPTEE | | Expression System | E.coli | | Molecular Weight | Predicted MW: 16.9 kDa
Observed MW: 15 kDa | | Purity | 锛?5% by SDS-PAGE | | Endotoxin | <0.1EU/渭g | | Conjugation | Unconjugated | | Tag | with N-His tag | | Physical Appearance | Liquid | | Storage Buffer | Supplied as a 0.2 渭m filtered solution of 50mM Tris-HCl (pH7.5), 300 mM NaCl, 5% glycerol. | | Stability & Storage | 12 months from date of receipt, -20鈩?as supplied. |
BackgroundBromodomain - containing protein 4 (BRD4) is a pivotal protein in epigenetic regulation. As a member of the BET (bromodomain and extra - terminal domain) family, it binds to acetylated lysine residues on histone tails via its bromodomains. This binding enables BRD4 to recruit transcriptional co - activators, such as the positive transcription elongation factor b (P - TEFb), and facilitate the transition from transcription initiation to elongation. In normal cells, BRD4 is involved in cell cycle progression, differentiation, and development. However, in cancer, aberrant BRD4 function is frequently observed. It drives the over - expression of oncogenes, fueling tumor cell growth, proliferation, and survival. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|