Login    Join free Add to favorites    中文
Home >Products> Reagents >ELISA / Diagnostic Kits> Human Glucagon like peptide 2 (GLP2) ELISA Kit
Human Glucagon like peptide 2 (GLP2) ELISA Kit
Human Glucagon like peptide 2 (GLP2) ELISA Kit
Origin of place China
Model KTE62531
Supplier Abbkine Scientific
Price
Hits 197
Updated 10/16/2019
  • Product Detail
  • Company Profile

GLP-2 is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion. When externally administered, GLP-2 produces a number of effects in humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection. GLP-2 may act in an endocrine fashion to link intestinal growth and metabolism with nutrient intake. GLP-2 and related analogs may be treatments for short bowel syndrome, Crohn's disease, osteoporosis and as adjuvant therapy during cancer chemotherapy.

Human Glucagon like peptide 2 (GLP2) ELISA Kit employs a two-site sandwich ELISA to quantitate GLP2 in samples. An antibody specific for GLP2 has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and anyGLP2 present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for GLP2 is added to the wells. After washing, Streptavidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of GLP2 bound in the initial step. The color development is stopped and the intensity of the color is measured.

Human Glucagon like peptide 2 (GLP2) ELISA Kit listed herein is for research use only and is not intended for use in human or clinical diagnosis. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license. We cannot be responsible for patent infringements or other violations that may occur with the use of this product.

Find more details at http://www.abbkine.com/product/human-glucagon-like-peptide-2-glp2-elisa-kit-kte62531/

bio-equip.cn
Request Infomation

* Name:
Title:
* Tel:
Fax:
* E-mail:
Postcode:
Institution/Company:
Address:
* Country:
Request infomation:
yes no
Request Quotation:
yes no
* Message:
Validated Code:
refresh
I agree to share my inquiry to the other matching suppliers.



Copyright(C) 2006-2026 Bio-Equip    E-mail:web@bio-equip.cn   沪ICP备06040519号