Description:	Recombinant Human Gastrin-17 Protein
Species:	Human
Express System：	Wheat Germ
Protein Length:	Full length protein
Concentration：	In the label
Purity:	>95% SDS-PAGE.
Tag:	GST tag N-Terminus
Sequence:	MQRLCVYVLIFALALAAFSEASWKPRSQQPDAPLGTGANRDL ELPWLEQQ GPASHHRRQLGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDF GRRSAEDE N
Amino Acid:	1-101
Storage:	Store at -20-80℃. Avoid repeated freeze/thaw cycles
Stability:	Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles
Applications:	ELISA ,WB, SDS-PAGE
Unit Size：	200μg, 500μg, 1000μg
Note:	Product is NOT sterile! Only for research use!

Ecalbio Co.,Ltd specialize in developing reagents of immunodiagnostic technology and biological systems with higher accuracy andreliability for results of the highest quality.

Ecalbio builds up professional platform to develop more than 10,000 products, including antibodies, antigens, biochemicals, ELISA kits, CLIA kits, and laboratory equipments,etc.

Ecalbio laboratories manufacture Antibodies, Proteins, Food safety ELISA kits, Food safety Rapid Tests, Animal Disease ELISA Kits, Animal Disease Rapid Test Kits, Laboratory equipments with incubators and diagnostic system.

Ecalbio has an enthusiastic and creative R&D team, consisting with a group of experienced technicians in lateral flow immunoassay field, and set up long relationship with first-class institutes,universities,academies, to provide excellent service for human healthy and earth.

Ecalbio are committed to saving lives by ensuring individuals worldwide have access to timely and correct diagnosis. Our products are used in over 100 countries worldwide by:
　Government Laboratories
　Food industry Laboratories
　Institutes
　Veterinary Clinics
　Pharmaceutical Industry.

Ecalbio welcomes potential partners and distributors to explorebusiness relationships with all customer in the worldwide, focused on scie-tech, integrity, quality and service for the customers.

ECALBIO CO.,LTD

HZAU, Luoshi road, Wuhan 430060, China
Tel:86-27-87745856
Email:info@ecalbio.com
Website: www.ecalbio.com